| Common name: | DCA1 |
| Defline: | (1 of 1) 4.1.1.50 - Adenosylmethionine decarboxylase / S-adenosyl-L-methionine decarboxylase; S-adenosylmethionine decarboxylase |
| Description: | produces decarboxylated S-adoMet for the fisrt step of polyamine biosynthesis; translationally regulated by a negatively acting uORF MPAVKRTSMRSVYDPIATEPIVASEPARLVVKRTACFADTGSLPS which is regulated in turn by an overlapping tiny ORF MSRPQDASC (PMID: 16176926); (adometdc) gi:57336132 |
| Synonyms: | DCA1,Cre03.g205900.t1.1,g4193.t1 |
| Chromosome: | chromosome 3 |
A plasmid for expressing Cre03.g205900 tagged with the fluorescent protein Venus and affinity epitope 3xFLAG is available: pLM005-Cre03.g205900-Venus-3xFLAG
No localization data is available in our datasets for this protein.
We did not determine any protein-protein interactions for this gene.
| Insertion Junction | Mutant Strain | Insertion Junction Feature | Confidence (%) | Genome Version |
|---|---|---|---|---|
| CLIP2.053479_1 | CLIP2.053479 | CDS | 80 | 6.1 |
| CLIP2.053760_1 | CLIP2.053760 | 3'UTR | 80 | 6.1 |
| CLIP2.053760_2 | CLIP2.053760 | 3'UTR | 80 | 6.1 |
| CLIP2.057710_1 | CLIP2.057710 | 5'UTR_intron | 80 | 6.1 |
| CLIP2.057710_2 | CLIP2.057710 | 5'UTR_intron | 80 | 6.1 |
| CLIP2.057970_1 | CLIP2.057970 | 5'UTR_intron | 80 | 6.1 |
| CLIP2.057970_2 | CLIP2.057970 | 5'UTR_intron | 80 | 6.1 |
| CLIP2.060911_1 | CLIP2.060911 | 5'UTR | 80 | 6.1 |
| CLIP2.060911_2 | CLIP2.060911 | 5'UTR | 80 | 6.1 |
| CLIP2.064746_1 | CLIP2.064746 | 5'UTR_intron | 80 | 6.1 |
| CLIP2.064746_2 | CLIP2.064746 | 5'UTR_intron | 80 | 6.1 |
| CLIP2.069291_1 | CLIP2.069291 | 5'UTR | 80 | 6.1 |
| CLIP2.069291_2 | CLIP2.069291 | 5'UTR | 80 | 6.1 |
| LMJ.RY0402.074167_1 | LMJ.RY0402.074167 | 3'UTR | 73 | 5.5 |
| PFAM: | PF01536 |
| PANTHER: | PTHR11570 PTHR11570:SF0 |
| KEGG_ec: | EC:4.1.1.50 |
| KEGG_orthology: | K01611 |
| KOG: | KOG0788 |
| Gene ontology terms:: | GO:0004014, GO:0006597, GO:0008295 |
| Best arabidopsis TAIR name: | AT3G02470 |
| Best arabidopsis TAIR symbol: | SAMDC |
| Best arabidopsis TAIR defline: | S-adenosylmethionine decarboxylase |
| Phytozome Locus Page |
Our phenotype screens did not find statistically significant results for this gene.